Proteintech, 10392-1-AP, USP2 Polyclonal antibody

Size: 20ul / 150ul The USP2 (10392-1-AP) by Proteintech is a Polyclonal antibody targeting USP2 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 10392-1-AP targets USP2 in WB, IHC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: NIH/3T3 cells, mouse brain tissue, mouse kidney tissue, MCF-7 cells, HEK-293 cells Positive IHC detected in: human breast cancer tissue, human prostate cancer tissue, human skeletal muscle tissue, mouse kidney tissue, rat liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse embryo tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information Ubiquitin, a highly conserved protein involved in the regulation of intracellular protein breakdown, cell cycle regulation, and stress response, is released from degraded proteins by disassembly of the polyubiquitin chains. The disassembly process is mediated by ubiquitin-specific proteases (USPs). USP2 is also named as UBP41. USP2 can interact indirectly with multiple clock proteins, so it remains possible that USP2 may modulate the ubiquitination and function of these other proteins. It has 4 isoforms produced by alternative splicing. This antibody is specific to the isoform 1(USP2a) of USP2. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0591 Product name: Recombinant human USP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 11-241 aa of BC002955 Sequence: YTESARYTDAHYAKSGYGAYTPSSYGANLAASLLEKEKLGFKPVPTSSFLTRPRTYGPSSLLDYDRGRPLLRPDITGGGKRAESQTRGTERPLGSGLSGGSGFPYGVTNNCLSYLPINAYDQGVTLTQKLDSQSDLARDFSSLRTSDSYRIDPRNLGRSPMLARTRKELCTLQGLYQTASCPEYLVDYLENYGRKGSASQVPSQAPPSRVPEIISPTYRPIGRYTLWETGK Predict reactive species Full Name: ubiquitin specific peptidase 2 Calculated Molecular Weight: 41 kDa, 69 kDa Observed Molecular Weight: 68 kDa GenBank Accession Number: BC002955 Gene Symbol: USP2 Gene ID (NCBI): 9099 RRID: AB_2212432 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75604 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.