Proteintech, 10396-1-AP, ANGPTL7 Polyclonal antibody

Size: 20ul / 150ul The ANGPTL7 (10396-1-AP) by Proteintech is a Polyclonal antibody targeting ANGPTL7 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 10396-1-AP targets ANGPTL7 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, MCF-7 cells Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: THP-1 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information ANGPTL7, also named as CDT6, is a member of the angiopoietin-like (ANGPTL) family of proteins, which are important regulators of Angiogenesis. It is a secreted 45-kDa glycoprotein that folds into a homotetramer structure linked by disulfide bonds. ANGPTL7 was originally discovered in the stromal layer of the corne, and moderately expressed in the human trabecular meshwork. The chromosomal location of the ANGPTL7 gene (1p36.22) is within the GLC3B locus (1p36.2-1p36.1) of primary congenital glaucoma, supporting ANGPTL7 as a candidate glaucoma gene. ANGPTL7 could have a pathogenic role in glaucoma, and may serve as a potential therapeutic target. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0596 Product name: Recombinant human ANGPTL7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 44-334 aa of BC001881 Sequence: NCCEEVKELKAQVANLSSLLSELNKKQERDWVSVVMQVMELESNSKRMESRLTDAESKYSEMNNQIDIMQLQAAQTVTQTSADAIYDCSSLYQKNYRISGVYKLPPDDFLGSPELEVFCDMETSGGGWTIIQRRKSGLVSFYRDWKQYKQGFGSIRGDFWLGNEHIHRLSRQPTRLRVEMEDWEGNLRYAEYSHFVLGNELNSYRLFLGNYTGNVGNDALQYHNNTAFSTKDKDNDNCLDKCAQLRKGGYWYNCCTDSNLNGVYYRLGEHNKHLDGITWYGWHGSTYSLKR Predict reactive species Full Name: angiopoietin-like 7 Calculated Molecular Weight: 40 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: BC001881 Gene Symbol: ANGPTL7 Gene ID (NCBI): 10218 RRID: AB_2057556 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O43827 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.