Proteintech, 10407-1-AP, Syntenin 2 Polyclonal antibody

Size: 20ul / 150ul The Syntenin 2 (10407-1-AP) by Proteintech is a Polyclonal antibody targeting Syntenin 2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 10407-1-AP targets Syntenin 2 in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse colon tissue, human liver tissue, mouse brain tissue, mouse heart tissue, rat colon tissue Positive IHC detected in: human breast cancer tissue, human gliomas tissue, rat colon tissue, human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information Syndecan-binding protein 2 (SDCBP2, Syntenin 2) is a protein containing two PDZ domains. PDZ domains facilitate protein-protein interactions by binding to the cytoplasmic C-terminus of transmembrane proteins. SDCBP2 binds with high affinity to PIP2 and is targeted to the plasma membrane, nucleoli and nuclear speckles via its PDZ domains (PMID: 15961997). SDCBP2 exists in two alternatively spliced variants, 2α and 2β, which differ in the lengths of their N-terminal regions. (PMID: 15276154) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0668 Product name: Recombinant human SDCBP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-207 aa of BC002727 Sequence: MVAPVTGYSLGVRRAEIKPGVREIHLCKDERGKTGLRLRKVDQGLFVQLVQANTPASLVGLRFGDQLLQIDGRDCAGWSSHKAHQVVKKASGDKIVVVVRDRPFQRTVTMHKDSMGHVGFVIKKGKIVSLVKGSSAARNGLLTNHYVCEVDGQNVIGLKDKKIMEILATAGNVVTLTIIPSVIYEHMVKKLPPVLLHHTMDHSIPDA Predict reactive species Full Name: syndecan binding protein (syntenin) 2 Calculated Molecular Weight: 32 kDa Observed Molecular Weight: 35-37 kDa GenBank Accession Number: BC002727 Gene Symbol: Syntenin 2 Gene ID (NCBI): 27111 RRID: AB_2183161 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H190 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.