Iright
BRAND / VENDOR: Proteintech

Proteintech, 10413-1-AP, PLUNC Polyclonal antibody

CATALOG NUMBER: 10413-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The PLUNC (10413-1-AP) by Proteintech is a Polyclonal antibody targeting PLUNC in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples 10413-1-AP targets PLUNC in WB, IHC, IF, IP, ChIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse lung tissue Positive IP detected in: mouse lung tissue Positive IHC detected in: mouse lung tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:400-1:1600 Background Information PLUNC, also named as LUNX, NASG and SPURT, belongs to the BPI/LBP/Plunc superfamily and Plunc family. PLUNC may be involved in the airway inflammatory response after exposure to irritants. It is associated with tumor progression. PLUNC plays a role in innate immune responses of the upper airways. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0629 Product name: Recombinant human PLUNC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-256 aa of BC012549 Sequence: MFQTGGLIVFYGLLAQTMAQFGGLPVPLDQTLPLNVNPALPLSPTGLAGSLTNALSNGLLSGGLLGILENLPLLDILKPGGGTSGGLLGGLLGKVTSVIPGLNNIIDIKVTDPQLLELGLVQSPDGHRLYVTIPLGIKLQVNTPLVGASLLRLAVKLDITAEILAVRDKQERIHLVLGDCTHSPGSLQISLLDGLGPLPIQGLLDSLTGILNKVLPELVQGNVCPLVNEVLRGLDITLVHDIVNMLIHGLQFVIKV Predict reactive species Full Name: palate, lung and nasal epithelium associated Calculated Molecular Weight: 27 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC012549 Gene Symbol: PLUNC Gene ID (NCBI): 51297 RRID: AB_2166093 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NP55 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924