Iright
BRAND / VENDOR: Proteintech

Proteintech, 10415-1-AP, Calpain 3 Polyclonal antibody

CATALOG NUMBER: 10415-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Calpain 3 (10415-1-AP) by Proteintech is a Polyclonal antibody targeting Calpain 3 in WB, IHC, ELISA applications with reactivity to human, mouse samples 10415-1-AP targets Calpain 3 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse skeletal muscle tissue Positive IHC detected in: human urothelial carcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:100-1:400 Background Information Calpain 3 (CAPN3), a major intracellular protease, is a muscle-specific member of the calpain large subunit family that specifically binds to titin. CAPN3 plays a role in the dysferlin protein complex and that disruption of CAPN3 function may affect muscle membrane repair and remodeling. CAPN3 has some isoforms with MW of 94, 84, 93, 36, 18 kDa. CAPN3 autolysis generates a small N-terminal fragment of 34 kDa and a large C-terminal fragment whose size ranges from 55 to 60 kDa during self-processing (PMID: 9794799, 14645524). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0671 Product name: Recombinant human CAPN3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-156 aa of BC003521 Sequence: MEICADELKKVLNTVVNKHKDLKTHGFTLESCRSMIALMDTDGSGKLNLQEFHHLWNKIKAWQKIFKHYDTDQSGTINSYEMRNAVNDAGFHLNNQLYDIITMRYADKHMNIDFDSFICCFVRLEGMFRAFHAFDKDGDGIIKLNVLEWLQLTMYA Predict reactive species Full Name: calpain 3, (p94) Calculated Molecular Weight: 94 kDa Observed Molecular Weight: 90-105 kDa, 55-60 kDa, 30-35 kDa GenBank Accession Number: BC003521 Gene Symbol: CAPN3 Gene ID (NCBI): 825 RRID: AB_2069647 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P20807 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924