Iright
BRAND / VENDOR: Proteintech

Proteintech, 10420-1-AP, SLC25A3 Polyclonal antibody

CATALOG NUMBER: 10420-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SLC25A3 (10420-1-AP) by Proteintech is a Polyclonal antibody targeting SLC25A3 in WB, IHC, ELISA applications with reactivity to human samples 10420-1-AP targets SLC25A3 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HepG2 cells, HeLa cells, MOLT-4 cells, PC-12 cells Positive IHC detected in: human lung cancer tissue, rat liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information The mitochondrial phosphate carrier SLC25A3 belongs to the SLC25 family , which is the largest family of solute carriers. SLC25A3 encodes the phosphate carrier PiC that catalyses the import of phosphate into mitochondria where it is needed for ATP synthesis. SLC25A3 has two isoforms SLC25A3-A (a heart-type isoform) and SLC25A3-B (a liver-type isoform) as a result of alternative splicing of exon 3. It has been reported that SLC25A3 mutations are associated with mitochondrial phosphate carrier deficiency, respiratory distress and hypertrophic cardiomyopathy. (PMID: 15984930, 27780865, 20877624) Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0667 Product name: Recombinant human SLC25A3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-361 aa of BC003504 Sequence: MFSSVAHLARANPFNTPHLQLVHDGLGDLRSSSPGPTGQPRRPRNLAAAAVEEYSCEFGSAKYYALCGFGGVLSCGLTHTAVVPLDLVKCRMQVDPQKYKGIFNGFSVTLKEDGVRGLAKGWAPTFLGYSMQGLCKFGFYEVFKVLYSNMLGEENTYLWRTSLYLAASASAEFFADIALAPMEAAKVRIQTQPGYANTLRDAAPKMYKEEGLKAFYKGVAPLWMRQIPYTMMKFACFERTVEALYKFVVPKPRSECSKPEQLVVTFVAGYIAGVFCAIVSHPADSVVSVLNKEKGSSASLVLKRLGFKGVWKGLFARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPEMPESLKKKLGLTQ Predict reactive species Full Name: solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 3 Calculated Molecular Weight: 40 kDa Observed Molecular Weight: 40-43 kDa GenBank Accession Number: BC003504 Gene Symbol: SLC25A3 Gene ID (NCBI): 5250 RRID: AB_2877735 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q00325 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924