Proteintech, 10430-1-AP, CDK5 Polyclonal antibody

Size: 20ul / 150ul The CDK5 (10430-1-AP) by Proteintech is a Polyclonal antibody targeting CDK5 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 10430-1-AP targets CDK5 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, HCT 116 cells, mouse pancreas tissue, NIH/3T3 cells, WB result of CDK5 antibody (10430-1-AP; 1:1000; room temperature for 1.5 hours) with wild-type and CDK5 knockout HCT 116 cells., mouse brain tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: mouse kidney tissue, human renal cell carcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Cyclin-dependent kinase 5 (CDK5), belongs to the cyclin-dependent kinase family, is a proline-directed serine/threonine-protein kinase that essential for neuronal cell cycle arrest and differentiation and may be involved in apoptotic cell death in neuronal diseases by triggering abortive cell cycle re-entry. CDK5 predominantly expressed in neurons where it phosphorylates both high molecular weight neurofilaments and microtubule-associated protein tau. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0686 Product name: Recombinant human CDK5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 92-273 aa of BC005115 Sequence: DSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQ Predict reactive species Full Name: cyclin-dependent kinase 5 Calculated Molecular Weight: 31 kDa, 33 kDa Observed Molecular Weight: 33 kDa GenBank Accession Number: BC005115 Gene Symbol: CDK5 Gene ID (NCBI): 1020 RRID: AB_2078859 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q00535 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.