Product Description
Size: 20ul / 150ul
The NGFRAP1 (10446-1-AP) by Proteintech is a Polyclonal antibody targeting NGFRAP1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples
10446-1-AP targets NGFRAP1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: HepG2 cells, mouse liver tissue
Positive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:1000-1:5000
Immunohistochemistry (IHC): IHC : 1:250-1:1000
Specification
Tested Reactivity: human, mouse, rat
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag0378 Product name: Recombinant human NGFRAP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 4-111 aa of BC003190 Sequence: IHQENEEMEQPMQNGEEDRPLGGGEGHQPAGNRRGQARRLAPNFRWAIPNRQINDGMGGDGDDMEIFMEEMREIRRKLRELQLRNCLRILMGELSNHHDHHDEFCLMP Predict reactive species
Full Name: nerve growth factor receptor (TNFRSF16) associated protein 1
Calculated Molecular Weight: 13 kDa, 22 kDa, 44 kDa
Observed Molecular Weight: 28 kDa
GenBank Accession Number: BC003190
Gene Symbol: NGFRAP1
Gene ID (NCBI): 27018
RRID: AB_2152792
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q00994
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924