Iright
BRAND / VENDOR: Proteintech

Proteintech, 10470-1-AP, CLINT1 Polyclonal antibody

CATALOG NUMBER: 10470-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CLINT1 (10470-1-AP) by Proteintech is a Polyclonal antibody targeting CLINT1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 10470-1-AP targets CLINT1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, HEK-293 cells, HeLa cells, Jurkat cells, mouse brain tissue Positive IP detected in: HeLa cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Clathrin interactor 1 (CLINT1), also known as enthoprotin or epsin-4, belongs to the epsin family of endocytic adapter proteins. CLINT1 interacts with clathrin, the adapter protein AP-1 and phosphoinositides. It may have a role in the formation of clathrin coated vesicles and trafficking between the trans-Golgi network and endosomes. Mutations in the gene of CLINT1 are associated with a susceptibility to schizophrenia and psychotic disorders. Calculated molecular weight of CLINT1 is 68 kDa. The migration of endogenous CLINT1 at 80 kDa has also been reported (PMID: 12213833; 15811338). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0754 Product name: Recombinant human CLINT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 326-625 aa of BC004467 Sequence: LVDLFDGTSQSTGGSADLFGGFADFGSAAASGSFPSQVTATSGNGDFGDWSAFNQAPSGPVASSGEFFGSASQPAVELVSGSQSALGPPPAASNSSDLFDLMGSSQATMTSSQSMNFSMMSTNTVGLGLPMSRSQNTDMVQKSVSKTLPSTWSDPSVNISLDNLLPGMQPSKPQQPSLNTMIQQQNMQQPMNVMTQSFGAVNLSSPSNMLPVRPQTNALIGGPMPMSMPNVMTGTMGMAPLGNTPMMNQSMMGMNMNIGMSAAGMGLTGTMGMGMPNIAMTSGTVQPKQDAFANFANFSK Predict reactive species Full Name: clathrin interactor 1 Calculated Molecular Weight: 68 kDa Observed Molecular Weight: 68 kDa, 80 kDa GenBank Accession Number: BC004467 Gene Symbol: CLINT1 Gene ID (NCBI): 9685 RRID: AB_2276405 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q14677 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924