Proteintech, 10477-1-AP, CHMP2A Polyclonal antibody

Size: 20ul / 150ul The CHMP2A (10477-1-AP) by Proteintech is a Polyclonal antibody targeting CHMP2A in WB, IHC, ELISA applications with reactivity to human samples 10477-1-AP targets CHMP2A in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HK-2 cells, HEK-293 cells, HeLa cells, HepG2 cells Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information CHMP2A, also known as Vps2-1, belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. CHMP2A is a component of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in the degradation of surface receptor proteins and the formation of endocytic multivesicular bodies (MVBs). It has been shown that CHMP2A can interact with and regulate the function of the AAA-ATPase VPS4B (PMID: 15173323). CHMP2A is also reported to be involved in HIV budding (PMID: 21396898; 23051622). Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0719 Product name: Recombinant human CHMP2A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-220 aa of BC002502 Sequence: MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAKQGQMDAVRIMAKDLVRTRRYVRKFVLMRANIQAVSLKIQTLKSNNSMAQAMKGVTKAMGTMNRQLKLPQIQKIMMEFERQAEIMDMKEEMMNDAIDDAMGDEEDEEESDAVVSQVLDELGLSLTDELSNLPSTGGSLSVAAGGKKAEAAASALADADADLEERLKNLR Predict reactive species Full Name: chromatin modifying protein 2A Calculated Molecular Weight: 25 kDa Observed Molecular Weight: 32 kDa GenBank Accession Number: BC002502 Gene Symbol: CHMP2A Gene ID (NCBI): 27243 RRID: AB_2079470 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O43633 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.