Iright
BRAND / VENDOR: Proteintech

Proteintech, 10479-2-AP, Annexin A11 Polyclonal antibody

CATALOG NUMBER: 10479-2-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Annexin A11 (10479-2-AP) by Proteintech is a Polyclonal antibody targeting Annexin A11 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 10479-2-AP targets Annexin A11 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A431 cells, HeLa cells, mouse uterus tissue Positive IP detected in: HeLa cells Positive IHC detected in: human ovary tumor tissue, human breast cancer tissue, human kidney tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Annexin A11 (Anxa11) is one member of annexins that are Ca2+-regulated phospholipid-binding proteins. Annexin A11 plays an important role in cell division, differentiation, apoptosis, vesicle trafficking and Ca2+ signaling (PMID: 31610865). ANXA11, an RNA granule-associated phosphoinositide-binding protein, acts as a molecular tether between RNA granules and lysosomes (PMID: 31539493). Annexin A11 dysregulation is involved in the progression, drug-resistance, recurrence of systemic autoimmune disease and cancer. Annexin A11, is involved in a variety of cellular functions including mRNA transport and translation, endocytosis, exocytosis, and plasma membrane repair (PMID: 38896345). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0729 Product name: Recombinant human ANXA11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-180 aa of BC007564 Sequence: MSYPGYPPPPGGYPPAAPGGGPWGGAAYPPPPSMPPIGLDNVATYAGQFNQDYLSGMAANMSGTFGGANMPNLYPGAPGAGYPPVPPGGFGQPPSAQQPVPPYGMYPPPGGNPPSRMPSYPPYPGAPVPGQPMPPPGQQPPGAYPGQPPVTYPGQPPVPLPGQQQPVPSYPGYPGSGTVT Predict reactive species Full Name: annexin A11 Calculated Molecular Weight: 56 kDa Observed Molecular Weight: 56-60 kDa GenBank Accession Number: BC007564 Gene Symbol: Annexin A11 Gene ID (NCBI): 311 RRID: AB_2057171 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P50995 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924