Proteintech, 10481-2-AP, DOK4 Polyclonal antibody

Size: 20ul / 150ul The DOK4 (10481-2-AP) by Proteintech is a Polyclonal antibody targeting DOK4 in WB, ELISA applications with reactivity to human, mouse, rat samples 10481-2-AP targets DOK4 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse skeletal muscle tissue, rat skeletal muscle tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information The INS-receptor substrate family plays important roles in cellular growth, signaling and survival. IRS5/DOK4 is a new member of this family identified, which is known as docking protein 4, or downstream of tyrosine kinase-4. DOK4 might have roles in INS and IGF-1 signaling as well. Expression of IRS5/DOK4 is regulated epigenetically via histone acetylating at its promoter. DOK4 is required at early stages in the myelination process, including the initial interaction with the axon, and is also involved in Schwann cell migration and proliferation, it also regulates GDNF-mediated neurite outgrowth during neuronal development through activation of the Rap1-ERK1/2 pathway. DOK4 may represent a novel negative regulator of T cells as other DOK family members like DOK1 and DOK2. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0734 Product name: Recombinant human DOK4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 227-326 aa of BC003541 Sequence: TLAIAEQHKRVLLEMEKNVRLLNKGTEHYSYPCTPTTMLPRSAYWHHITGSQNIAEASSYAGEGYGAAQASSETDLLNRFILLKPKPSQGDSSEAKTPSQ Predict reactive species Full Name: docking protein 4 Calculated Molecular Weight: 37 kDa Observed Molecular Weight: 37 kDa GenBank Accession Number: BC003541 Gene Symbol: DOK4 Gene ID (NCBI): 55715 RRID: AB_2246205 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8TEW6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.