Iright
BRAND / VENDOR: Proteintech

Proteintech, 10486-1-AP, JUNB Polyclonal antibody

CATALOG NUMBER: 10486-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The JUNB (10486-1-AP) by Proteintech is a Polyclonal antibody targeting JUNB in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 10486-1-AP targets JUNB in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HT-1080 cells, HeLa cells, MCF-7 cells, MDA-MB-231 cells Positive IP detected in: HeLa cells Positive IHC detected in: human lymphoma tissue, human breast cancer tissue, human ovary tissue, human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information JunB is one of the components of the Activator Protein-1 (AP-1) transcription complex that have been implicated in the control ofthe G0/G1 transtion in fibroblasts. AP-1 is a collection of dimers formed by members of the Jun-, Fos-, ATF- and Maf multigene families that bind to specific DNA regulatory elements called AP-1/12-O-tetradecanoylphorbol-13-acetate-responsive elements (TREs) and cAMP-responsive elements (CREs). JunB binds to the DNA sequence 5'-TGA[CG]TCA-3', and involves in the regulation of gene activity following the primary growth factor response. It also acts either as a tumor suppressor or as an oncogene depending on the cell and physiopathological context Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0752 Product name: Recombinant human JUNB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-200 aa of BC004250 Sequence: MCTKMEQPFYHDDSYTATGYGRAPGGLSLHDYKLLKPSLAVNLADPYRSLKAPGARGPGPEGGGGGSYFSGQGSDTGASLKLASSELERLIVPNSNGVITTTPTPPGQYFYPRGGGSGGGAGGAGGGVTEEQEGFADGFVKALDDLHKMNHVTPPNVSLGATGGPPAGPGGVYAGPEPPPVYTNLSSYSPASASSGGAGA Predict reactive species Full Name: jun B proto-oncogene Calculated Molecular Weight: 36 kDa Observed Molecular Weight: 38 kDa, 42 kDa GenBank Accession Number: BC004250 Gene Symbol: JUNB Gene ID (NCBI): 3726 RRID: AB_2129996 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P17275 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924