Proteintech, 10496-1-AP, HOXD3 Polyclonal antibody

Size: 20ul / 150ul The HOXD3 (10496-1-AP) by Proteintech is a Polyclonal antibody targeting HOXD3 in IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 10496-1-AP targets HOXD3 in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Homeobox D3 (HOXD3), a member of the Homeobox (Hox) family of master transcription factors, is a homeobox transcription factor that promotes angiogenesis and collagen synthesis. HOXD3 is expressed during normal embryogenesis, skin development, and fetal wound healing (PMID: 14633614). The overexpression of HOXD3 plays a critical role in breast cancer stemness and drug resistance via integrin β3-mediated Wnt/β-catenin signaling (PMID: 29698974). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0768 Product name: Recombinant human HOXD3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-200 aa of BC005124 Sequence: MLFEQGQQALELPECTMQKAAYYENPGLFGGYGYSKTTDTYGYSTPHQPYPPPAAASSLDTDYPGSACSIQSSAPLRAPAHKGAELNGSCMRPGTGNSQGGGGGSQPPGLNSEQQPPQPPPPPPTLPPSSPTNPGGGVPAKKPKGGPNASSSSATISKQIFPWMKESRQNSKQKNSCATAGESCEDKSPPGPASKRVRTA Predict reactive species Full Name: homeobox D3 Calculated Molecular Weight: 46 kDa GenBank Accession Number: BC005124 Gene Symbol: HOXD3 Gene ID (NCBI): 3232 RRID: AB_2233224 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P31249 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.