Proteintech, 10509-1-Ig, RhoGDI Polyclonal antibody

Size: 20ul / 150ul The RhoGDI (10509-1-Ig) by Proteintech is a Polyclonal antibody targeting RhoGDI in WB, IHC, ELISA applications with reactivity to human, mouse samples 10509-1-Ig targets RhoGDI in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Jurkat cells, A431 cells, mouse pancreas tissue, HL-60 cells, HeLa cells, HEK-293 cells Positive IHC detected in: human breast cancer tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information Rho GDP-dissociation inhibitor (RhoGDI), also called ARHGDIA, is one member of ARHGDIs, which is ubiquitously expressed and interacts with several Rho GTPases, mainly including RhoA, Rac1, and Cdc42. RhoGDI can inhibit nucleotide exchange and membrane association to downregulate the activities of Rho family GTPase. It is overexpressed in various human cancers. Activity of this protein is important in a variety of cellular processes, and it is overexpressed in various human cancers. Mutations in RhoGDI have been found in individuals with nephrotic syndrome, type 8. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0791 Product name: Recombinant human ARHGDIA,aGDI protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-204 aa of BC005851 Sequence: MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDWKD Predict reactive species Full Name: Rho GDP dissociation inhibitor (GDI) alpha Calculated Molecular Weight: 28 kDa Observed Molecular Weight: 28 kDa GenBank Accession Number: BC005851 Gene Symbol: RhoGDI Gene ID (NCBI): 396 RRID: AB_2059582 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P52565 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.