Product Description
Size: 20ul / 150ul
The BLK (10510-1-AP) by Proteintech is a Polyclonal antibody targeting BLK in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples
10510-1-AP targets BLK in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: Jurkat cells, Raji cells, SH-SY5Y cells
Positive IP detected in: SH-SY5Y cells
Positive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:500-1:1000
Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC): IHC : 1:50-1:500
Background Information
Tyrosine-protein kinase Blk(BLK) is typically involved in cell proliferation and differentiation.BLK is a 58 kDa protein with important role in B-cell receptor signaling and B-cell development. BLK also stimulates INS synthesis and secretion in response to glucose and enhances the expression of several pancreatic beta-cell transcription factors.
Specification
Tested Reactivity: human, mouse, rat
Cited Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag0795 Product name: Recombinant human BLK protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-100 aa of BC007371 Sequence: MGLVSSKKPDKEKPIKEKDKGQWSPLKVSAQDKDAPPLPPLVVFNHLTPPPPDEHLDEDKHFVVALYDYTAMNDRDLQMLKGEKLQVLKGTGDWWLARSL Predict reactive species
Full Name: B lymphoid tyrosine kinase
Calculated Molecular Weight: 58 kDa
Observed Molecular Weight: 58 kDa
GenBank Accession Number: BC007371
Gene Symbol: BLK
Gene ID (NCBI): 640
RRID: AB_2274754
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P51451
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924