Iright
BRAND / VENDOR: Proteintech

Proteintech, 10514-2-AP, Kallikrein 5 Polyclonal antibody

CATALOG NUMBER: 10514-2-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Kallikrein 5 (10514-2-AP) by Proteintech is a Polyclonal antibody targeting Kallikrein 5 in IHC, ELISA applications with reactivity to human, mouse samples 10514-2-AP targets Kallikrein 5 in WB, IF, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: human skin tissue, mouse skin tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information KLK5(Kallikrein-5) is also named as SCTE and belongs to the kallikrein subfamily. This protein is predicted to be a secreted serine protease, and the enzyme is found to have proteolytic activity. In serum and ascites fluid, the protein is present in two forms, one at a relatively lower molecular mass (around 50 kDa), and another one around 150-180 kDa and native KLK5 is highly glycosylated or that it may interact with the gel filtration column, leading to delayed retention(PMID:12873991). The activation of the enzyme has been shown to require cleavage of an arginine residue (Arg66-Ile67), suggesting that a trypsin-like serine protease may be involved in this process(PMID:15713679). Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0799 Product name: Recombinant human KLK5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 72-280 aa of BC008036 Sequence: DCDMHTQPWQAALLLRPNQLYCGAVLVHPQWLLTAAHCRKKVFRVRLGHYSLSPVYESGQQMFQGVKSIPHPGYSHPGHSNDLMLIKLNRRIRPTKDVRPINVSSHCPSAGTKCLVSGWGTTKSPQVHFPKVLQCLNISVLSQKRCEDAYPRQIDDTMFCAGDKAGRDSCQGDSGGPVVCNGSLQGLVSWGDYPCARPNRPGVYTNLCK Predict reactive species Full Name: kallikrein-related peptidase 5 Calculated Molecular Weight: 32 kDa GenBank Accession Number: BC008036 Gene Symbol: KLK5 Gene ID (NCBI): 25818 RRID: AB_2134374 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y337 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924