Iright
BRAND / VENDOR: Proteintech

Proteintech, 10526-1-AP, RRM1 Polyclonal antibody

CATALOG NUMBER: 10526-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The RRM1 (10526-1-AP) by Proteintech is a Polyclonal antibody targeting RRM1 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat, monkey samples 10526-1-AP targets RRM1 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat, monkey samples. Tested Applications Positive WB detected in: A431 cells, HeLa cells, A549 cells, K-562 cells, BxPC-3 cells, HEK-293 cells, U-251 cells Positive IP detected in: K-562 cells Positive IHC detected in: human breast cancer tissue, human lung cancer tissue, human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells, Raji cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:100-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information Ribonucleoside-diphosphate reductase large subunit (RRM1) is the main enzyme forde novodeoxyribonucleotidesynthesis necessary for DNA synthesis during the cell cycle as well as during DNA repair.What is the molecular weight of RRM1?The molecular weight of RRM1 is 90 kDa. RRM1 is a part of ribonucleotide reductase (RNR), which is composedof two large RRM1 and two small RRM2 subunits in S phase and two large RRM1 and twoalternative smallp53R2subunits in non-dividing quiescent cells (PMID: 17416930).What is the subcellular localization of RRM1?RRM1 localizes to the cytoplasm, where it is responsible for dNTP production, forming a complex with RRM2.However, RRM1 can be recruited to DNA damage sites in the nucleus via interaction with Tip60 (PMID: 20159953).What is the tissue expression pattern of RRM1?RRM1 is ubiquitously expressed.How is RRM1 expression regulated during the cell cycle and upon DNA damage?Rrm1gene expression levels depend on the cell cycle, and the highest mRNA levels are observed in S phase.However, RRM1 protein levels are constant throughout the cell cycle due to long protein half-life, contrary toRRM2,which is actively degraded after cell exit from S phase. During DNA damage, e.g., induced withgenotoxinsor UVlight, expression of RRM1 and RRM2/p53R2 is upregulated (PMID: 1551913 and 8798592). Specification Tested Reactivity: human, mouse, rat, monkey Cited Reactivity: human, mouse, xenopus Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0789 Product name: Recombinant human RRM1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 593-792 aa of BC006498 Sequence: IRNSLLIAPMPTASTAQILGNNESIEPYTSNIYTRRVLSGEFQIVNPHLLKDLTERGLWHEEMKNQIIACNGSIQSIPEIPDDLKQLYKTVWEISQKTVLKMAAERGAFIDQSQSLNIHIAEPNYGKLTSMHFYGWKQGLKTGMYYLRTRPAANPIQFTLNKEKLKDKEKVSKEEEEKERNTAAMVCSLENRDECLMCGS Predict reactive species Full Name: ribonucleotide reductase M1 Calculated Molecular Weight: 90 kDa Observed Molecular Weight: 90 kDa GenBank Accession Number: BC006498 Gene Symbol: RRM1 Gene ID (NCBI): 6240 RRID: AB_2180372 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P23921 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924