Proteintech, 10540-1-AP, GTF2A2 Polyclonal antibody

Size: 20ul / 150ul The GTF2A2 (10540-1-AP) by Proteintech is a Polyclonal antibody targeting GTF2A2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 10540-1-AP targets GTF2A2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, HeLa cells Positive IHC detected in: mouse liver tissue, mouse heart tissue, rat liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information Transcription mediated by RNA polymerase II depends on a set of different transcription factors to form the pre-initiation complex. TFIIA is involved in the construction of this complex and increases the affinity of TBP for the DNA union region [PMID:20480367]. TFIIA in a complex with TBP mediates transcriptional activity [PMID: 11030333]. GTF2A2 is one subunit of TFIIA. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0825 Product name: Recombinant human GTF2A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-109 aa of BC001919 Sequence: MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE Predict reactive species Full Name: general transcription factor IIA, 2, 12kDa Calculated Molecular Weight: 12 kDa Observed Molecular Weight: 12 kDa GenBank Accession Number: BC001919 Gene Symbol: GTF2A2 Gene ID (NCBI): 2958 RRID: AB_2114351 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P52657 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.