Proteintech, 10541-1-AP, Calmodulin Polyclonal antibody

Size: 20ul / 150ul The Calmodulin (10541-1-AP) by Proteintech is a Polyclonal antibody targeting Calmodulin in WB, IHC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples 10541-1-AP targets Calmodulin in WB, IHC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse skeletal muscle tissue, HepG2 cells, mouse brain tissue, MCF-7 cells, HeLa cells, NCCIT cells, rat skeletal muscle tissue Positive IP detected in: Ramos cells Positive IHC detected in: human breast cancer tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive FC (Intra) detected in: HeLa cells, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information Calmodulin (CaM) is a Ca(2+)-binding protein that transduces Ca2+-mediated signals by binding to and regulating the activity of hundreds of enzymes and non-enzymatic proteins. It is highly conserved across species and involved in many biological processes, including vesicle release, cell proliferation, and apoptosis. This antibody can recognize CALM1, CALM2 and CALM3. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, bovine Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0827 Product name: Recombinant human CALM3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-147 aa of BC006182 Sequence: MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDESLSMPLISSFCPRLFHPCLPRPDAFIS Predict reactive species Full Name: calmodulin 3 (phosphorylase kinase, delta) Calculated Molecular Weight: 17 kDa Observed Molecular Weight: 17 kDa GenBank Accession Number: BC006182 Gene Symbol: Calmodulin 3 Gene ID (NCBI): 808 RRID: AB_2069442 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P62158 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.