Iright
BRAND / VENDOR: Proteintech

Proteintech, 10569-1-AP, Integrin alpha-5/CD49e Polyclonal antibody

CATALOG NUMBER: 10569-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Integrin alpha-5/CD49e (10569-1-AP) by Proteintech is a Polyclonal antibody targeting Integrin alpha-5/CD49e in WB, IHC, ELISA applications with reactivity to human, mouse, monkey samples 10569-1-AP targets Integrin alpha-5/CD49e in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, monkey samples. Tested Applications Positive WB detected in: A549 cells, 3T3-L1 cells, COS-7 cells, HeLa cells, human placenta tissue, Calu-1 cells, NIH/3T3 cells Positive IHC detected in: human placenta tissue, human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:300-1:1200 Background Information Integrins are cell adhesion receptors that are heterodimers composed of non-covalently associated alpha and beta subunits. Integrin alpha 5 (ITGA5), belongs to the integrin alpha chain family, primarily binds to Integrin beta 1 (ITGB1) to form an α5β1 heterodimer (PMID: 33711961). Integrin α5β1 is a specific receptor of fibronectin through its arginine-glycine-aspartic acid (RGD) binding site (PMID: 19608542). Integrin α5β1 plays roles in cell adhesion, migration and matrix formation, and has emerged as an essential mediator in many human carcinomas (PMID: 33408483). Specification Tested Reactivity: human, mouse, monkey Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0860 Product name: Recombinant human Integrin alpha-5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 749-1049 aa of BC008786 Sequence: FTVPHLRDTKKTIQFDFQILSKNLNNSQSDVVSFRLSVEAQAQVTLNGVSKPEAVLFPVSDWHPRDQPQKEEDLGPAVHHVYELINQGPSSISQGVLELSCPQALEGQQLLYVTRVTGLNCTTNHPINPKGLELDPEGSLHHQQKREAPSRSSASSGPQILKCPEAECFRLRCELGPLHQQESQSLQLHFRVWAKTFLQREHQPFSLQCEAVYKALKMPYRILPRQLPQKERQVATAVQWTKAEGSYGVPLWIIILAILFGLLLLGLLIYILYKLGFFKRSLPYGTAMEKAQLKPPATSDA Predict reactive species Full Name: integrin, alpha 5 (fibronectin receptor, alpha polypeptide) Calculated Molecular Weight: 115 kDa Observed Molecular Weight: 135-150 kDa GenBank Accession Number: BC008786 Gene Symbol: Integrin alpha 5 Gene ID (NCBI): 3678 RRID: AB_2130060 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P08648 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924