Iright
BRAND / VENDOR: Proteintech

Proteintech, 10592-1-AP, DLX5 Polyclonal antibody

CATALOG NUMBER: 10592-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The DLX5 (10592-1-AP) by Proteintech is a Polyclonal antibody targeting DLX5 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 10592-1-AP targets DLX5 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, A375 cells, U-251 cells Positive IHC detected in: human thymus tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information DLX5 belongs to the DLX family of homeobox transcription factors (Dlx1, Dlx2, Dlx5 and Dlx6), which is expressed in overlapping domains at different stages of cell differentiation in the subpallium and controls differentiation of GABAergic neurons. DLX5 is an immediate early BMP-responsive transcriptional activator that essential for osteoblast differentiation. It can bind to and stimulate the homeodomain-response element of the ALPL and SP7 promoter. DLX5 can form homodimer with DLX2(~34kd) and heterodimer with MSX2(~29kd). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0910 Product name: Recombinant human DLX5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-289 aa of BC006226 Sequence: MTGVFDRRVPSIRSGDFQAPFQTSAAMHHPSQESPTLPESSATDSDYYSPTGGAPHGYCSPTSASYGKALNPYQYQYHGVNGSAGSYPAKAYADYSYASSYHQYGGAYNRVPSATNQPEKEVTEPEVRMVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNKRSKIKKIMKNGEMPPEHSPSSSDPMACNSPQSPAVWEPQGSSRSLSHHPHAHPPTSNQSPASSYLENSASWYTSAASSINSHLPPPGSLQHPLALASGTLY Predict reactive species Full Name: distal-less homeobox 5 Calculated Molecular Weight: 32 kDa Observed Molecular Weight: 35 kDa GenBank Accession Number: BC006226 Gene Symbol: DLX5 Gene ID (NCBI): 1749 RRID: AB_2090724 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P56178 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924