Iright
BRAND / VENDOR: Proteintech

Proteintech, 10611-2-AP, COX10 Polyclonal antibody

CATALOG NUMBER: 10611-2-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The COX10 (10611-2-AP) by Proteintech is a Polyclonal antibody targeting COX10 in WB, ELISA applications with reactivity to human, mouse, rat samples 10611-2-AP targets COX10 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Background Information Cytochrome c oxidase (COX) is the terminal enzyme in the electron transfer chain located in the mitochondrial inner membrane. It catalyzes the electron transfer from reduced cytochrome c to oxygen. COX10 is predicted to contain 7-9 transmembrane domains, and it is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes heme A:farnesyltransferase, which is required for the expression of functional COX and functions in the maturation of the heme A prosthetic group of COX. In addition, COX10 may play a certain role in the development and progression of azoospermia. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0930 Product name: Recombinant human COX10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-300 aa of BC006394 Sequence: MAASPHTLSSRLLTGCVGGSVWYLERRTIQDSPHKFLHLLRNVNKQWITFQHFSFLKRMYVTQLNRSHNQQVRPKPEPVASPFLEKTSSGQAKAEIYEMRPLSPPSLSLSRKPNEKELIELEPDSVIEDSIDVGKETKEEKRWKEMKLQVYDLPGILAQLSKIKLTALVVSTTAAGFALAPGPFDWPCFLLTSVGTGLASCAANSINQFFEVPFDSNMNRTKNRPLVRGQISPLLAVSFATCCAVPGVAILTLGVNPLTGALGLFNIFLYTCCYTPLKRISIANTWVGAVVGAIPPVMGW Predict reactive species Full Name: COX10 homolog, cytochrome c oxidase assembly protein, heme A: farnesyltransferase (yeast) Calculated Molecular Weight: 51 kDa Observed Molecular Weight: 51 kDa GenBank Accession Number: BC006394 Gene Symbol: COX10 Gene ID (NCBI): 1352 RRID: AB_2084833 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q12887 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924