Iright
BRAND / VENDOR: Proteintech

Proteintech, 10620-1-AP, SDHB Polyclonal antibody

CATALOG NUMBER: 10620-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SDHB (10620-1-AP) by Proteintech is a Polyclonal antibody targeting SDHB in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples 10620-1-AP targets SDHB in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, HeLa cells, Jurkat cells, mouse liver tissue, rat liver tissue Positive IP detected in: HEK-293 cells Positive IHC detected in: human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Positive FC (Intra) detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:100-1:400 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information SDHB(Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial) is also named as SDH, SDH1 and belongs to the succinate dehydrogenase/fumarate reductase iron-sulfur protein family. The SDHD, SDHB, and SDHC genes encode subunits of mitochondrial complex II (succinate dehydrogenase). Mitochondrial complex II is a heterotetrameric complex involved in the aerobic electron transport chain and catalyses the oxidation of succinate to fumarate (Krebs cycle) with transport of electrons to the ubiquinone pool. SDHA and SDHB are the hydrophilic catalytic part of the complex and are highly conserved(J Med Genet 2004;41:e99). Defects in SDHB are a cause of susceptibility to pheochromocytoma (PCC), paragangliomas type 4 (PGL4), paraganglioma and gastric stromal sarcoma (PGGSS) and Cowden-like syndrome (CWDLS). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, zebrafish Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0968 Product name: Recombinant human SDHB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-280 aa of BC007840 Sequence: MAAVVALSLRRRLPATTLGGACLQASRGAQTAAATAPRIKKFAIYRWDPDKAGDKPHMQTYEVDLNKCGPMVLDALIKIKNEVDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLNKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKEKKASV Predict reactive species Full Name: succinate dehydrogenase complex, subunit B, iron sulfur (Ip) Calculated Molecular Weight: 32 kDa Observed Molecular Weight: 28-32 kDa GenBank Accession Number: BC007840 Gene Symbol: SDHB Gene ID (NCBI): 6390 RRID: AB_2285522 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P21912 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924