Proteintech, 10640-1-AP, EIF3K Polyclonal antibody

Size: 20ul / 150ul The EIF3K (10640-1-AP) by Proteintech is a Polyclonal antibody targeting EIF3K in WB, ELISA applications with reactivity to human samples 10640-1-AP targets EIF3K in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, NCI-H1299 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1000 Product name: Recombinant human EIF3K protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-218 aa of BC007559 Sequence: MAMFEQMRANVGKLLKGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAFFQTTVTAQILLKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAFWQALDENMDLLEGITGFEDSVRKFICHVVGITYQHIDRWLLAEMLGDLSDSQLKVWMSKYGWSADESGQIFICSQEESIKPKNIVEKIDFDSVSSIMASSQ Predict reactive species Full Name: eukaryotic translation initiation factor 3, subunit K Calculated Molecular Weight: 28 kDa GenBank Accession Number: BC007559 Gene Symbol: EIF3K Gene ID (NCBI): 27335 RRID: AB_2262100 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UBQ5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.