Proteintech, 10642-1-AP, PGF/PIGF Polyclonal antibody

Size: 20ul / 150ul The PGF/PIGF (10642-1-AP) by Proteintech is a Polyclonal antibody targeting PGF/PIGF in IHC, ELISA applications with reactivity to human, mouse samples 10642-1-AP targets PGF/PIGF in IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: human placenta tissue, human breast cancer tissue, human kidney tissue, human meningioma tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information Placenta growth factor (PLGF) is also named as PGF and PGFL. PGF is a homodimeric glycoprotein, 46-50 kDa in size, belonging to the vascular endothelial growth factor (VEGF) sub-family. It plays an important role in pathological VEGF-driven angiogenesis. PLGF is expressed not only in placental cells but also in colon and mammary carcinomas. It acts as a primary inflammatory instigator of atherosclerotic plaque instability and thus may be useful as a risk-predicting biomarker in patients with acute coronary syndromes (ACS). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0969 Product name: Recombinant human PGF protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-170 aa of BC007789 Sequence: MPVMRLFPCFLQLLAGLALPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVPRR Predict reactive species Full Name: placental growth factor Calculated Molecular Weight: 25 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC007789 Gene Symbol: PGF Gene ID (NCBI): 5228 RRID: AB_2161061 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P49763 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.