Proteintech, 10654-1-AP, Hsc70 Polyclonal antibody

Size: 20ul / 150ul The Hsc70 (10654-1-AP) by Proteintech is a Polyclonal antibody targeting Hsc70 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 10654-1-AP targets Hsc70 in WB, IHC, IF/ICC, IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, MCF-7 cells, PC-12 cells, HeLa cells, NIH/3T3 cells, U-87 MG cells, mouse brain tissue, rat brain tissue Positive IHC detected in: human ovary tumor tissue, human renal cell carcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information HSPA8 (also known as HSC70) is a member of the HSPA (HSP70) family of heat-shock proteins which are highly conserved chaperons implicated in protein folding, protein refolding, protein transport, and protein targeting. HSPA8 is a constitutively expressed cytosol/nuclear protein able to translocate between cytoplasm and nucleus. Recently it has been reported that HSPA8 can interact with α-synuclein, the critical pathological protein of Parkinson's disease, indicating its implication in neurodegenerative disease (21832061). In addition, this antibody is most likely able to recognize Hsp70. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig, goat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1018 Product name: Recombinant human Hsc70 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 288-587 aa of BC007276 Sequence: QKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD Predict reactive species Full Name: heat shock 70kDa protein 8 Calculated Molecular Weight: 70 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC007276 Gene Symbol: HSC70 Gene ID (NCBI): 3312 RRID: AB_2120153 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P11142 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.