Iright
BRAND / VENDOR: Proteintech

Proteintech, 10656-1-AP, DENR Polyclonal antibody

CATALOG NUMBER: 10656-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The DENR (10656-1-AP) by Proteintech is a Polyclonal antibody targeting DENR in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse samples 10656-1-AP targets DENR in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A431 cells, mouse lung tissue, HEK-293 cells, mouse brain tissue Positive IP detected in: HeLa cells Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HEK-293 cells, A431 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information DENR, also named as SMAP-3 or DRP1, is a 198 amino acid protein, which is highly expressed in heart and skeletal muscle and moderately expressed in the brain, placenta, liver and pancreas. DENR is Up-regulated with increasing cell-density by HNRNPD and Up-regulated in ovarian and breast cancer cells by ERBB2 overexpression. The calculated molecular weight of DENR is 22 kDa, but the modified protein is about 25-30 kDa. (PMID: 27239039 ) Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat, pig, zebrafish Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1023 Product name: Recombinant human DENR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-198 aa of BC007860 Sequence: MAADISESSGADCKGDPRNSAKLDADYPLRVLYCGVCSLPTEYCEYMPDVAKCRQWLEKNFPNEFAKLTVENSPKQEAGISEGQGTAGEEEEKKKQKRGGRGQIKQKKKTVPQKVTIAKIPRAKKKYVTRVCGLATFEIDLKEAQRFFAQKFSCGASVTGEDEIIIQGDFTDDIIDVIQEKWPEVDDDSIEDLGEVKK Predict reactive species Full Name: density-regulated protein Calculated Molecular Weight: 27 kDa Observed Molecular Weight: 27-30 kDa GenBank Accession Number: BC007860 Gene Symbol: DENR Gene ID (NCBI): 8562 RRID: AB_2092124 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O43583 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924