Iright
BRAND / VENDOR: Proteintech

Proteintech, 10657-1-AP, FBXW4 Polyclonal antibody

CATALOG NUMBER: 10657-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The FBXW4 (10657-1-AP) by Proteintech is a Polyclonal antibody targeting FBXW4 in WB, IHC, ELISA applications with reactivity to human, mouse samples 10657-1-AP targets FBXW4 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse lung tissue, mouse liver tissue Positive IHC detected in: human pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information F-box proteins have been shown to be critical for the ubiquitin-mediated degradation of cellular regulatory proteins, and they are a family of eukaryotic proteins characterized by an approximately 40 amino acid motif. SCF complex, a class of ubiquitin ligases, consists of invariable components, Skp1 and Cullin, and variable components of F-box proteins, which have a primary role in determining substrate specificity. FBXW4, also known as SHFM3, encodes F-box and WD-40 domain-containing protein 4. Defects in SHFM3 are a cause of split-hand/foot malformation type 3 (SHFM3), an autosomal dominant disorder characterized by hypoplasia/aplasia of the central digits with fusion of the remaining digits. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1047 Product name: Recombinant human FBXW4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-293 aa of BC007380 Sequence: QMPWMQLEDDSLYISQANFILAYQFRPDGASLNRRPLGVFAGHDEDVCHFVLANSHIVSAGGDGKIGIHKIHSTFTVKYSAHEQEVNCVDCKGGIIVSGSRDRTAKVWPLASGRLGQCLHTIQTEDRVWSIAISPLLSSFVTGTACCGHFSPLRIWDLNSGQLMTHLGSDFPPGAGVLDVMYESPFTLLSCGYDTYVRYWDLRTSVRKCVMEWEEPHDSTLYCLQTDGNHLLATGSSYYGVVRPWDRRQRACLHAFPLTSTPLSSPVYCLRLTTKHLYAALSYNLHVLDFQNP Predict reactive species Full Name: F-box and WD repeat domain containing 4 Calculated Molecular Weight: 46 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC007380 Gene Symbol: FBXW4 Gene ID (NCBI): 6468 RRID: AB_2102754 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P57775 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924