Iright
BRAND / VENDOR: Proteintech

Proteintech, 10688-1-AP, STRADB Polyclonal antibody

CATALOG NUMBER: 10688-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The STRADB (10688-1-AP) by Proteintech is a Polyclonal antibody targeting STRADB in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 10688-1-AP targets STRADB in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Raji cells, mouse heart tissue Positive IHC detected in: human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:100-1:400 Background Information The 418 amino acid STRADB protein, which is also named as ALS2CR2 and ILPIP, contains a putative N-terminal ATP-binding site, a protein kinase domain, and several C-terminal phosphorylation sites. STRADB potentiates the antiapoptotic activity of XIAP by enhancing XIAP-mediated activation of JNK1 and other JNK family members, but not by modulating XIAP-mediated caspase inhibition. This protein has 3 isoforms produced by alternative splicing with the MW of 47 kDa, 42 kDa and 31 kDa. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1040 Product name: Recombinant human STRADB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 119-418 aa of BC008302 Sequence: ITTYWTVFTVGSWLWVISPFMAYGSASQLLRTYFPEGMSETLIRNILFGAVRGLNYLHQNGCIHRSIKASHILISGDGLVTLSGLSHLHSLVKHGQRHRAVYDFPQFSTSVQPWLSPELLRQDLHGYNVKSDIYSVGITACELASGQVPFQDMHRTQMLLQKLKGPPYSPLDISIFPQSESRMKNSQSGVDSGIGESVLVSSGTHTVNSDRLHTPSSKTFSPAFFSLVQLCLQQDPEKRPSASSLLSHVFFKQMKEESQDSILSLLPPAYNKPSISLPPVLPWTEPECDFPDEKDSYWEF Predict reactive species Full Name: STE20-related kinase adaptor beta Calculated Molecular Weight: 47 kDa Observed Molecular Weight: 28-31 kDa, 38-42 kDa GenBank Accession Number: BC008302 Gene Symbol: STRADB Gene ID (NCBI): 55437 RRID: AB_2197715 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9C0K7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924