Proteintech, 10696-1-AP, FBXO7 Polyclonal antibody

Size: 20ul / 150ul The FBXO7 (10696-1-AP) by Proteintech is a Polyclonal antibody targeting FBXO7 in WB, IHC, ELISA applications with reactivity to human samples 10696-1-AP targets FBXO7 in WB, IHC, CoIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells Positive IHC detected in: human stomach tissue, human intrahepatic cholangiocarcinomaNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information FBXO7, also named as FBX7, is a substrate recognition component of a (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. FBXO7 recognizes BIRC2 and DLGAP5. It function in phosphorylation-dependent ubiquitination. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1035 Product name: Recombinant human FBXO7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 220-522 aa of BC008361 Sequence: KALSMPEKWKLSGVYKLQYMHPLCEGSSATLTCVPLGNLIVVNATLKINNEIRSVKRLQLLPESFICKEKLGENVANIYKDLQKLSRLFKDQLVYPLLAFTRQALNLPDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCRDLFTASNDPLLWRFLYLRDFRDNTVRVQDTDWKELYRKRHIQRKESPKGRFVMLLPSSTHTIPFYPNPLHPRPFPSSRLPPGIIGGEYDQRPTLPYVGDPISSLIPGPGETPSQFPPLRPRFDPVGPLPGPNPILPGRGGPNDRFPFRPSRGRPTDGRLSFM Predict reactive species Full Name: F-box protein 7 Calculated Molecular Weight: 59 kDa Observed Molecular Weight: 59-75 kDa GenBank Accession Number: BC008361 Gene Symbol: FBXO7 Gene ID (NCBI): 25793 RRID: AB_2246820 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y3I1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.