Iright
BRAND / VENDOR: Proteintech

Proteintech, 10698-1-AP, KMO Polyclonal antibody

CATALOG NUMBER: 10698-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The KMO (10698-1-AP) by Proteintech is a Polyclonal antibody targeting KMO in IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 10698-1-AP targets KMO in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: human kidney tissue, human prostate cancer tissue, human breast cancer tissue, mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information KMO(Kynurenine 3-monooxygenase) is an NADPH-dependent flavin monooxygenase, catalysing the hydroxylation of the L-kynurenine to form L-3-hydroxykynurenine. KMO is a membrane protein located on the outer membrane of mitochondria. Tissue distribution studies have revealed that, in rats, highest enzyme activity is found in kidney and liver, with brain having the least activity in comparison to peripheral organs(PMID: 9237672). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1109 Product name: Recombinant human KMO protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 107-407 aa of BC005297 Sequence: LSVSRENLNKDLLTAAEKYPNVKMHFNHRLLKCNPEEGMITVLGSDKVPKDVTCDLIVGCDGAYSTVRSHLMKKPRFDYSQQYIPHGYMELTIPPKNGDYAMEPNYLHIWPRNTFMMIALPNMNKSFTCTLFMPFEEFEKLLTSNDVVDFFQKYFPDAIPLIGEKLLVQDFFLLPAQPMISVKCSSFHFKSHCVLLGDAAHAIVPFFGQGMNAGFEDCLVFDELMDKFSNDLSLCLPVFSRLRIPDDHAISDLSMYNYIEKNMERFLHAIMPSTFIPLYTMVTFSRIRYHEAVQRWHWQKR Predict reactive species Full Name: kynurenine 3-monooxygenase (kynurenine 3-hydroxylase) Calculated Molecular Weight: 486 aa, 56 kDa Observed Molecular Weight: 56 kDa GenBank Accession Number: BC005297 Gene Symbol: KMO Gene ID (NCBI): 8564 RRID: AB_2296744 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O15229 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924