Iright
BRAND / VENDOR: Proteintech

Proteintech, 10699-1-AP, SUMO2/3 Polyclonal antibody

CATALOG NUMBER: 10699-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SUMO2/3 (10699-1-AP) by Proteintech is a Polyclonal antibody targeting SUMO2/3 in WB, ELISA applications with reactivity to human samples 10699-1-AP targets SUMO2/3 in WB, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information Ubiquitin is most famous for its function in targeting proteins for degradation by the 26S proteasome, ubiquitin needs to be attached to a substrate in chains (polyubiquitylation) before being recognized by proteasome. Similarly, SUMO (small ubiquitin-related modifier) can be linked to substrates in chains (polysumoylation), SUMO modification has been implicated in many important cellular processes including the control of genome stability, signal transduction, targeting to and formation of nuclear compartments, cell cycle and meiosis. There are 4 confirmed SUMO isoforms in human, SUMO-1, SUMO-2, SUMO-3 and SUMO-4. SUMO-2 and SUMO-3 are nearly identical but are distinct from SUMO-1. SUMO2/3 conjugation was recently widely involved in neuroprotective activities. A substitution (M55V) of SUMO4 was strongly associated with the pathogenesis of type 1 diabetes (T1D) involving NF kappa B related mechanisms. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1135 Product name: Recombinant human SUMO3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-103 aa of BC008420 Sequence: MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVPESSLAGHSF Predict reactive species Full Name: SMT3 suppressor of mif two 3 homolog 3 (S. cerevisiae) Calculated Molecular Weight: 12 kDa Observed Molecular Weight: 11-20 kDa GenBank Accession Number: BC008420 Gene Symbol: SUMO3 Gene ID (NCBI): 6612 RRID: AB_3669122 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P55854 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924