Product Description
Size: 20ul / 150ul
The HINT1 (10717-1-AP) by Proteintech is a Polyclonal antibody targeting HINT1 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples
10717-1-AP targets HINT1 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: Jurkat cells, rat brain tissue, rat thymus tissue, K-562 cells, Raji cells
Positive IP detected in: mouse brain tissue
Positive IHC detected in: human colon cancer tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:500-1:2000
Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC): IHC : 1:300-1:1200
Background Information
HINT1(Histidine triad nucleotide-binding protein 1) is also named as HINT, PKCI1, PRKCNH1,which is a member of the histidine triad (HIT) family, highly conserved in diverse species and ubiquitously expressed in mammalian tissues.It hydrolyzes adenosine 5'-monophosphoramidate substrates such as AMP-morpholidate, AMP-N-alanine methyl ester, AMP-alpha-acetyl lysine methyl ester and AMP-NH2.This antibody is specific to HINT1.
Specification
Tested Reactivity: human, mouse, rat
Cited Reactivity: human, mouse, rat
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag1142 Product name: Recombinant human HINT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-126 aa of BC007090 Sequence: MADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQISVAEDDDESLLGHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMHWPPG Predict reactive species
Full Name: histidine triad nucleotide binding protein 1
Calculated Molecular Weight: 14 kDa
Observed Molecular Weight: 14 kDa
GenBank Accession Number: BC007090
Gene Symbol: HINT1
Gene ID (NCBI): 3094
RRID: AB_2248272
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P49773
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924