Proteintech, 10718-1-AP, Cyclin H Polyclonal antibody

Size: 20ul / 150ul The Cyclin H (10718-1-AP) by Proteintech is a Polyclonal antibody targeting Cyclin H in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples 10718-1-AP targets Cyclin H in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A431 cells, A375 cells, mouse brain tissue, HuH-7 cells, HeLa cells, Jurkat cells, K-562 cells, NIH/3T3 cells Positive IP detected in: HeLa cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Positive FC (Intra) detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1088 Product name: Recombinant human CCNH protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-323 aa of BC005280 Sequence: MYHNSSQKRHWTFSSEEQLARLRADANRKFRCKAVANGKVLPNDPVFLEPHEEMTLCKYYEKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLRESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYPILENPEILRKTADDFLNRIALTDAYLLYTPSQIALTAILSSASRAGITMESYLSESLMLKENRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLERCHSAELALNVITKKRKGYEDDDYVSKKSKHEEEEWTDDDLVESL Predict reactive species Full Name: cyclin H Calculated Molecular Weight: 38 kDa Observed Molecular Weight: 38 kDa GenBank Accession Number: BC005280 Gene Symbol: Cyclin H Gene ID (NCBI): 902 RRID: AB_2073749 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P51946 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.