Proteintech, 10726-1-AP, ATIC Polyclonal antibody

Size: 20ul / 150ul The ATIC (10726-1-AP) by Proteintech is a Polyclonal antibody targeting ATIC in WB, IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 10726-1-AP targets ATIC in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HCT 116 cells, HeLa cells, HepG2 cells, Jurkat cells Positive IF/ICC detected in: HeLa cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunofluorescence (IF)/ICC: IF/ICC : 1:300-1:1200 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information 5-Aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase (ATIC, also known as AICAR) is an enzyme that can catalyse the last two reactions in the de novo purine biosynthetic pathway, has been previously reported to be upregulated and to participate in myeloma and hepatocellular carcinoma progression (PMID: 35251351). Specification Tested Reactivity: human Cited Reactivity: human, mouse, zebrafish Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1052 Product name: Recombinant human ATIC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 291-592 aa of BC008879 Sequence: DLYKTLTPISAAYARARGADRMSSFGDFVALSDVCDVPTAKIISREVSDGIIAPGYEEEALTILSKKKNGNYCVLQMDQSYKPDENEVRTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIVATIAVKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGDKANYWWLRHHPQVLSMKFKTGVKRAEISNAIDQYVTGTIGEDEDLIKWKALFEEVPELLTEAEKKEWVEKLTEVSISSDAFFPFRDNVDRAKRSGVAYIAAPSGSAADKVVIEACDELGIILAHTNLRLFHH Predict reactive species Full Name: 5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase Calculated Molecular Weight: 65 kDa Observed Molecular Weight: 65 kDa GenBank Accession Number: BC008879 Gene Symbol: ATIC Gene ID (NCBI): 471 RRID: AB_2062475 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P31939 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.