Proteintech, 10731-1-AP, MYOT Polyclonal antibody

Size: 20ul / 150ul The MYOT (10731-1-AP) by Proteintech is a Polyclonal antibody targeting MYOT in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 10731-1-AP targets MYOT in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse skeletal muscle tissue, mouse heart tissue Positive IHC detected in: mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information MYOT (myotilin) is a structural protein of the striated muscle Z-discs. It interacts with both actinin and filamin, forming a complex to maintain structural stability of muscles. In adult tissues, myotilin is mainly expressed in skeletal and cardiac muscles and in the peripheral nerves. Missense mutations of myotilin cause limb girdle muscular dystrophy 1A and some other myopathy. Two isoforms of MYOT exist due to the alternative splicing. This antibody can detect both of isoforms around 57 kDa and 35 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1112 Product name: Recombinant human MYOT protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 191-498 aa of BC005376 Sequence: GPQNAAAVFQAQDDSGAQDSQQHNSEHARLQVPTSQVRSRSTSRGDVNDQDAIQEKFYPPRFIQVPENMSIDEGRFCRMDFKVSGLPAPDVSWYLNGRTVQSDDLHKMIVSEKGLHSLIFEVVRASDAGAYACVAKNRAGEATFTVQLDVLAKEHKRAPMFIYKPQSKKVLEGDSVKLECQISAIPPPKLFWKRNNEMVQFNTDRISLYQDNTGRVTLLIKDVNKKDAGWYTVSAVNEAGVTTCNTRLDVTARPNQTLPAPKQLRVRPTFSKYLALNGKGLNVKQAFNPEGEFQRLAAQSGLYESEEL Predict reactive species Full Name: myotilin Calculated Molecular Weight: 55 kDa Observed Molecular Weight: 55-57 kDa, 35 kDa GenBank Accession Number: BC005376 Gene Symbol: MYOT Gene ID (NCBI): 9499 RRID: AB_2297956 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UBF9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.