Proteintech, 10751-1-AP, NIPSNAP3A Polyclonal antibody

Size: 20ul / 150ul The NIPSNAP3A (10751-1-AP) by Proteintech is a Polyclonal antibody targeting NIPSNAP3A in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 10751-1-AP targets NIPSNAP3A in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, COLO 320 cells, HEK-293 cells, rat brain tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1143 Product name: Recombinant human NIPSNAP3A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-247 aa of BC005935 Sequence: MLVLRSALTRALASRTLAPQMCSSFATGPRQYDGIFYEFRSYYLKPSKMNEFLENFEKNAHLRTAHSELVGYWSVEFGGRMNTVFHIWKYDNFAHRTEVRKALAKDKEWQEQFLIPNLALIDKQESEITYLVPWCKLEKPPKEGVYELATFQMKPGGPALWGDAFKRAVHAHVNLGYTKLVGVFHTEYGALNRVHVLWWNESADSRAAGRHKSHEDPRVVAAVRESVNYLVSQQNMLLIPTSFSPLK Predict reactive species Full Name: nipsnap homolog 3A (C. elegans) Calculated Molecular Weight: 28 kDa Observed Molecular Weight: 28-33 kDa GenBank Accession Number: BC005935 Gene Symbol: NIPSNAP3A Gene ID (NCBI): 25934 RRID: AB_2298420 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UFN0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.