Iright
BRAND / VENDOR: Proteintech

Proteintech, 10788-1-AP, RAB3C Polyclonal antibody

CATALOG NUMBER: 10788-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The RAB3C (10788-1-AP) by Proteintech is a Polyclonal antibody targeting RAB3C in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 10788-1-AP targets RAB3C in WB, IP, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, human brain tissue, mouse lung tissue, rat brain tissues Positive IP detected in: mouse brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Rab proteins are small molecular weight GTPases that control vesicular traffic in eukaryotic cells. A subset of Rab proteins, the Rab3 proteins (Rab3A, Rab3B, Rab3C, and Rab3D) are thought to play an important role in regulated exocytosis of vesicles. Although Rab3 proteins are highly homologous, displaying 77-85% amino acid identity with greatest variance evident within the N- and C-terminal regions, their subcellular targets and functional roles remain somewhat distinct between them. RT-PCR analysis indicated that human Rab3C was expressed in the human brain, placenta, and lung. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1241 Product name: Recombinant human RAB3C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-227 aa of BC013033 Sequence: MRHEAPMQMASAQDARYGQKDSSDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFKNEKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVILVGNKCDMEDERVISTERGQHLGEQLGFEFFETSAKDNINVKQTFERLVDIICDKMSESLETDPAITAAKQNTRLKETPPPPQPNCAC Predict reactive species Full Name: RAB3C, member RAS oncogene family Calculated Molecular Weight: 26 kDa Observed Molecular Weight: 28 kDa GenBank Accession Number: BC013033 Gene Symbol: RAB3C Gene ID (NCBI): 115827 RRID: AB_2177217 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96E17 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924