Proteintech, 10789-1-AP, SLC25A13 Polyclonal antibody

Size: 20ul / 150ul The SLC25A13 (10789-1-AP) by Proteintech is a Polyclonal antibody targeting SLC25A13 in IHC, IF/ICC, ELISA applications with reactivity to human samples 10789-1-AP targets SLC25A13 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information SLC25A13, also known as citrin, has been identified as a mitochondrial aspartate-glutamate carrier protein and may be implicated in metabolic compartmentation. It consists of 675 amino acid residues and harbors four EF-hands and six mitochondrial transmembranous (TM) spanners. Mutations in SLC25A13 gene cause adult-onset type II citrullinemia (CTLN2) and neonatal intrahepatic cholestasis (NICCD). The complete deletion or cleaved SLA25A13 proteins have been reported in patients with SLC25A13 mutation. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1242 Product name: Recombinant human SLC25A13 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 336-675 aa of BC006566 Sequence: SVAGAVGATAVYPIDLVKTRMQNQRSTGSFVGELMYKNSFDCFKKVLRYEGFFGLYRGLLPQLLGVAPEKAIKLTVNDFVRDKFMHKDGSVPLAAEILAGGCAGGSQVIFTNPLEIVKIRLQVAGEITTGPRVSALSVVRDLGFFGIYKGAKACFLRDIPFSAIYFPCYAHVKASFANEDGQVSPGSLLLAGAIAGMPAASLVTPADVIKTRLQVAARAGQTTYSGVIDCFRKILREEGPKALWKGAGARVFRSSPQFGVTLLTYELLQRWFYIDFGGVKPMGSEPVPKSRINLPAPNPDHVGGYKLAVATFAGIENKFGLYLPLFKPSVSTSKAIGGGP Predict reactive species Full Name: solute carrier family 25, member 13 (citrin) Calculated Molecular Weight: 74 kDa GenBank Accession Number: BC006566 Gene Symbol: SLC25A13 Gene ID (NCBI): 10165 RRID: AB_2189738 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UJS0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.