Iright
BRAND / VENDOR: Proteintech

Proteintech, 10795-1-AP, Sestrin 2 Polyclonal antibody

CATALOG NUMBER: 10795-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Sestrin 2 (10795-1-AP) by Proteintech is a Polyclonal antibody targeting Sestrin 2 in WB, IHC, IF/ICC, IF-P, IP, ELISA applications with reactivity to human, mouse samples 10795-1-AP targets Sestrin 2 in WB, IHC, IF/ICC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, human brain tissue, human liver tissue, NIH/3T3 cells, rat liver tissue, K-562 cells, mouse kidney tissue, A2780 cells, RAW 264.7 cells Positive IP detected in: K-562 cells Positive IHC detected in: human breast cancer tissue, human ovary tumor tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse kidney tissue Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information SESN is a family of highly conserved, stress-inducible genes that can defend the cell against oxidative damage and oncogenic signaling. SESN2 ,which belongs to the SESN family, has been implicated as a tumor suppressor that can inhibit angiogenesis and promote autophagy, underscoring the importance of elucidating the molecular mechanism by which SESN2 regulates pathways of metabolism and survival.(PMID:22363791). Sesn2 encodes a 480 amino acid protein which can run as a 60 kDa band on SDS-polyacrylamide gel electrophoresis(PMID:20878915). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat, pig, bovine Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1247 Product name: Recombinant human Sestrin2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 132-480 aa of BC013304 Sequence: HMAEFLQTGGDPEWLLGLHRAPEKLRKLSEINKLLAHRPWLITKEHIQALLKTGEHTWSLAELIQALVLLTHCHSLSSFVFGCGILPEGDADGSPAPQAPTPPSEQSSPPSRDPLNNSGGFESARDVEALMERMQQLQESLLRDEGTSQEEMESRFELEKSESLLVTPSADILEPSPHPDMLCFVEDPTFGYEDFTRRGAQAPPTFRAQDYTWEDHGYSLIQRLYPEGGQLLDEKFQAAYSLTYNTIAMHSGVDTSVLRRAIWNYIHCVFGIRYDDYDYGEVNQLLERNLKVYIKTVACYPEKTTRRMYNLFWRHFRHSEKVHVNLLLLEARMQAALLYALRAITRYMT Predict reactive species Full Name: sestrin 2 Calculated Molecular Weight: 54 kDa Observed Molecular Weight: 54-60 kDa GenBank Accession Number: BC013304 Gene Symbol: SESN2/Sestrin 2 Gene ID (NCBI): 83667 RRID: AB_2185480 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P58004 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924