Proteintech, 10809-1-AP, LIX/CXCL5 Polyclonal antibody

Size: 20ul / 150ul The LIX/CXCL5 (10809-1-AP) by Proteintech is a Polyclonal antibody targeting LIX/CXCL5 in WB, IHC, ELISA applications with reactivity to human samples 10809-1-AP targets LIX/CXCL5 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: PMA treated A549 cells Positive IHC detected in: human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information Chemokines are a class of pro-inflammatory cytokines that can recruit and activate chemotactic cells. CXCL5 is a member of the chemokine family binding CXCR2, a G-protein coupled receptor. CXCL5 is a chemokine that promotes tumor formation by triggering the migration of immune cells to tumors and promotes immmuno-suppressive characteristics of the tumor microenvironment. CXCL5 can also promote tumor cell metastasis and recruit vascular endothelial cells for angiogenesis. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1079 Product name: Recombinant human CXCL5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-114 aa of BC008376 Sequence: MSLLSSRAARVPGPSSSLCALLVLLLLLTQPGPIASAGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN Predict reactive species Full Name: chemokine (C-X-C motif) ligand 5 Calculated Molecular Weight: 12 kDa Observed Molecular Weight: 10-12 kDa GenBank Accession Number: BC008376 Gene Symbol: CXCL5 Gene ID (NCBI): 6374 RRID: AB_2292366 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P42830 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.