Iright
BRAND / VENDOR: Proteintech

Proteintech, 10812-1-AP, Kallikrein 2 Polyclonal antibody

CATALOG NUMBER: 10812-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Kallikrein 2 (10812-1-AP) by Proteintech is a Polyclonal antibody targeting Kallikrein 2 in WB, IHC, ELISA applications with reactivity to human, mouse samples 10812-1-AP targets Kallikrein 2 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse pancreas tissue Positive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information KLK2(Kallikrein-2) is also named as hGK-1 and belongs to the Kallikrein subfamily. It plays a role in prostate cancer susceptibility and this role may be realized at least in part by the induction of increases in its production. It also may mediate tumor growth and invasion by participating in proteolytic cascades. This protein has 4 isoforms produced by alternative splicing with the molecular weight of 29 kDa, 25 kDa, 18 kDa and 17 kDa. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1077 Product name: Recombinant human KLK2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-261 aa of BC005196 Sequence: MWDLVLSIALSVGCTGAVPLIQSRIVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWVLTAAHCLKKNSQVWLGRHNLFEPEDTGQRVPVSHSFPHPLYNMSLLKHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASGWGSIEPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFMLCAGLWTGGKDTCGGDSGGPLVCNGVLQGITSWGPEPCALPEKPAVYTKVVHYRKWIKDTIAANP Predict reactive species Full Name: kallikrein-related peptidase 2 Calculated Molecular Weight: 28 kDa Observed Molecular Weight: 29 kda GenBank Accession Number: BC005196 Gene Symbol: KLK2 Gene ID (NCBI): 3817 RRID: AB_2134232 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P20151 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924