Iright
BRAND / VENDOR: Proteintech

Proteintech, 10823-1-AP, Cystatin B Polyclonal antibody

CATALOG NUMBER: 10823-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Cystatin B (10823-1-AP) by Proteintech is a Polyclonal antibody targeting Cystatin B in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human samples 10823-1-AP targets Cystatin B in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human saliva tissue, MCF-7 cells, HepG2 cells, human saliva Positive IP detected in: MCF-7 cells Positive IHC detected in: human colon tissue, human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Cystatin B (CSTB), a member of the cystatin superfamily protein, is a stefin that functions as an intracellular thiol protease inhibitor and has been thought to play a role in protecting against the proteases leaking from lysosomes. CSTB plays various functions in a variety of diseases, including epithelial ovarian cancer, colon cancer, and myoclonus epilepsy. Evidence indicates that mutations in CSTB are responsible for the primary defects in patients with progressive myoclonic epilepsy (EPM1). One type of mutation responsible for EPM1 is the expansion in the promoter region of this gene of a CCCCGCCCCGCG repeat from 2-3 copies to 30-78 copies. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1262 Product name: Recombinant human CSTB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-98 aa of BC003370 Sequence: MMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF Predict reactive species Full Name: cystatin B (stefin B) Calculated Molecular Weight: 11 kDa Observed Molecular Weight: 11 kDa GenBank Accession Number: BC003370 Gene Symbol: Cystatin B Gene ID (NCBI): 1476 RRID: AB_2086100 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P04080 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924