Iright
BRAND / VENDOR: Proteintech

Proteintech, 10839-1-AP, TADA3L Polyclonal antibody

CATALOG NUMBER: 10839-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The TADA3L (10839-1-AP) by Proteintech is a Polyclonal antibody targeting TADA3L in WB, IHC, ELISA applications with reactivity to human, mouse samples 10839-1-AP targets TADA3L in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, NIH/3T3 cells, human brain tissue, Jurkat cells Positive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:9000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information TADA3 is a subunit of 2 histone acetyltransferase complexes: the ADA2A (TADA2A)-containing (ATAC) complex and the SPT3 (SUPT3H)-TAF9-GCN5 (KAT2A)/PCAF (KAT2B) acetylase (STAGA) complex. The ATAC complex is a complex with histone acetyltransferase activity on histones H3 and H4, and the PCAF complex is capable of efficiently acetylating histones in a nucleosomal context. TADA3 is also known as a coactivator for p53/TP53-dependent transcriptional activation. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1276 Product name: Recombinant human TADA3L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-369 aa of BC009240 Sequence: MSELKDCPLQFHDFKSVDHLKVCPRYTAVLARSEDDGIGIEELDTLQLELETLLSSASRRLRVLEAETQILTDWQDKKGDRRFLKLGRDHELGAPPKHGKPKKQKLEGKAGHGPGPGPGRPKSKNLQPKIQEYEFTDDPIDVPRIPKNDAPNRFWASVEPYCADITSEEVRTLEELLKPPEDEAEHYKIPPLGKHYSQRWAQEDLLEEQKDGARAAAVADKKKGLMGPLTELDTKDVDALLKKSEAQHEQPEDGCPFGALTQRLLQALVEENIISPMEDSPIPDMSGKESGADGASTSPRNQNKPFSVPHTKSLESRIKEELIAQGLLESEDRPAEDSEDEVLAELRKRQAELKALSAHNRTKKHDLLR Predict reactive species Full Name: transcriptional adaptor 3 (NGG1 homolog, yeast)-like Calculated Molecular Weight: 41 kDa Observed Molecular Weight: 49 kDa GenBank Accession Number: BC009240 Gene Symbol: TADA3L Gene ID (NCBI): 10474 RRID: AB_513667 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75528 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924