Proteintech, 10842-1-AP, Alpha Synuclein Polyclonal antibody

Size: 20ul / 150ul The Alpha Synuclein (10842-1-AP) by Proteintech is a Polyclonal antibody targeting Alpha Synuclein in WB, IHC, IF/ICC, IF-Fro, ELISA applications with reactivity to human, mouse, rat samples 10842-1-AP targets Alpha Synuclein in WB, IHC, IF/ICC, IF-Fro, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, human brain tissue, rat brain tissue Positive IHC detected in: mouse brain tissue, human kidney tissue, human placenta tissue, human testis tissue, human skin tissue, human lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-Fro detected in: rat brain tissue Positive IF/ICC detected in: SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-FRO: IF-FRO : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Alpha Synuclein (α-syn) is a 14-19 kDa phosphoprotein that is primarily localize to the presynaptic terminals of mature neurons, where it is involved in synaptic function and plasticity. Α-syn has drawn intense interest ever since the late 1990s, when the first α-synuclein missense mutation was identified as a cause of familial Parkinson's disease (PD). Aggregated and hyper-phosphorylated forms of α-syn protein are the pathological hallmark of Lewy body disease, which includes Parkinson's disease (PD), diffuse Lewy body disease (DLBD), and Lewy body variant of Alzheimer's disease (LBV). This antibody can recognize all the isoforms of α-syn. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, yeast, zebra finch Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1285 Product name: Recombinant human a-Synuclein protein Source: e coli. -derived, PKG Tag: GST Domain: 1-140 aa of BC013293 Sequence: MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA Predict reactive species Full Name: synuclein, alpha (non A4 component of amyloid precursor) Calculated Molecular Weight: 14 kDa Observed Molecular Weight: 15-19 kDa GenBank Accession Number: BC013293 Gene Symbol: Alpha Synuclein Gene ID (NCBI): 6622 RRID: AB_2192672 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P37840 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.