Iright
BRAND / VENDOR: Proteintech

Proteintech, 10863-2-AP, LYPLA3 Polyclonal antibody

CATALOG NUMBER: 10863-2-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The LYPLA3 (10863-2-AP) by Proteintech is a Polyclonal antibody targeting LYPLA3 in WB, IHC, ELISA applications with reactivity to human, mouse samples 10863-2-AP targets LYPLA3 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse spleen tissue, mouse kidney tissue Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information PLA2G15 is also named as LYPLA3 and belongs to the AB hydrolase superfamily. It has transacylase and calcium-independent phospholipase A2 activity. PLA2G15 catalyzes the formation of 1-O-acyl-N-acetylsphingosine and the concomitant release of a lyso-phospholipid. It can be detected as 42-47 kDa and 57 kDa due to the N-glycosylated modification (PMID:11790796). Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1304 Product name: Recombinant human PLA2G15 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-277 aa of BC011640 Sequence: SYFHTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQLYGGPVVLVAHSMGNMYTLYFLQRQPQAWKDKYIRAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNYTWSPEKVFVQTPTINYTLRDYRKFFQDIGFEDGWLMRQDTEGLVEATMPPGVQLHCLYGTGVPTPDSFYYESFPDRDPKICFGDGDGTVNLKSALQCQAWQSRQEHQVLLQELPGSEHIEMLANATTLAYLKRVLLGP Predict reactive species Full Name: phospholipase A2, group XV Calculated Molecular Weight: 47 kDa Observed Molecular Weight: 42-57 kDa GenBank Accession Number: BC011640 Gene Symbol: PLA2G15 Gene ID (NCBI): 23659 RRID: AB_2283832 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NCC3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924