Proteintech, 10905-1-AP, ING3 Polyclonal antibody

Size: 20ul / 150ul The ING3 (10905-1-AP) by Proteintech is a Polyclonal antibody targeting ING3 in WB, IHC, ELISA applications with reactivity to human, mouse samples 10905-1-AP targets ING3 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse uterus tissue, HepG2 cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information Members of inhibitor of growth (ING) family function in inhibiting cell growth and inducing apoptosis. They are sequence homologous proteins. ING3 can activate p53 trans-activated promoters, including promoters of p21/waf1 and bax. This antibody is specifically against p47ING3. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1357 Product name: Recombinant human ING3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-92 aa of BC009777 Sequence: MLYLEDYLEMIEQLPMDLRDRFTEMREMDLQVQNAMDQLEQRVSEFFMNAKKNKPEWREEQMASIKKDYYKALEDADEKVQLANQIYDLQHF Predict reactive species Full Name: inhibitor of growth family, member 3 Calculated Molecular Weight: 46 kDa Observed Molecular Weight: 47 kDa GenBank Accession Number: BC009777 Gene Symbol: ING3 Gene ID (NCBI): 54556 RRID: AB_2127780 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NXR8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.