Iright
BRAND / VENDOR: Proteintech

Proteintech, 10918-1-AP, CDC27; APC3 Polyclonal antibody

CATALOG NUMBER: 10918-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CDC27; APC3 (10918-1-AP) by Proteintech is a Polyclonal antibody targeting CDC27; APC3 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 10918-1-AP targets CDC27; APC3 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells, K-562 cells Positive IP detected in: K-562 cells Positive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information CDC27/APC3 is a component of the anaphase-promoting complex (APC/cyclosome), which is composed of eight subunits and highly conserved in eukaryotic cells. The APC/cyclosome complex acts as a cell cycle-regulated E3 ubiquitin ligase which mediates ubiquitination and subsequent degradation of target proteins, and lead to the progression control through mitosis and the G1 phase of the cell cycle. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1345 Product name: Recombinant human CDC27; APC3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 481-830 aa of BC011656 Sequence: ALCSYNCKEAINILSHLPSHHYNTGWVLCQIGRAYFELSEYMQAERIFSEVRRIENYRVEGMEIYSTTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPNYAYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQKALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAIVIDPKNPLCKFHRASVLFANEKYKSALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAIDKRYLPDDEEPITQEEQIMGTDESQESSMTDADDTQLHAAESDEF Predict reactive species Full Name: cell division cycle 27 homolog (S. cerevisiae) Calculated Molecular Weight: 92 kDa Observed Molecular Weight: 92 kDa GenBank Accession Number: BC011656 Gene Symbol: CDC27 Gene ID (NCBI): 996 RRID: AB_2075288 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P30260 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924