Iright
BRAND / VENDOR: Proteintech

Proteintech, 10919-1-AP, SF3B2 Polyclonal antibody

CATALOG NUMBER: 10919-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SF3B2 (10919-1-AP) by Proteintech is a Polyclonal antibody targeting SF3B2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 10919-1-AP targets SF3B2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, K-562 cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information SF3B (splicing factor 3B) is a U2 snRNP-associated protein complex essential for spliceosome assembly. SF3B complex contains the spliceosome-associated protein (SAP) 49, 130, 145, and 155 has been demonstrated. And this complex is essential for U2 snRNP to anchor to the pre-mRNA. Splicing factor 3B subunit 2 (SF3B2), known as SAP145, forms complex with SAP49 which plays a role in cell cycle progression. SAP145, with predicated MW of 100 kDa, appears with MW of about 145 kDa which may be due to the post-translational modification. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1009 Product name: Recombinant human SF3B2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 331-636 aa of BC007610 Sequence: LYYEGKEFETRLKEKKPGDLSDELRISLGMPVGPNAHKVPPPWLIAMQRYGPPPSYPNLKIPG LNSPIPESCSFGYHAGGWGKPPVDETGKPLYGDVFGTNAAEFQTKTEEEEIDRTPWGELEPSD EESSEEEEEEESDEDKPDETGFITPADSGLITPGGFSSVPAGMETPELIELRKKKIEEAMDGSETPQ LFTVLPEKRTATVGGAMMGSTHIYDMSTVMSRKGPAPELQGVEVALAPEELELDPMAMTQKY EEHVREQQAQVEKEDFSDMVAEHAAKQKQKKRKAQPQDSRGGSKKYKEFKF Predict reactive species Full Name: splicing factor 3b, subunit 2, 145kDa Calculated Molecular Weight: 100 kDa Observed Molecular Weight: 130-140 kDa GenBank Accession Number: BC007610 Gene Symbol: SF3B2 Gene ID (NCBI): 10992 RRID: AB_2285782 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13435 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924